PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009596112.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 276aa    MW: 31747.4 Da    PI: 5.5876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009596112.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed +l++ +   G  +W+ +++  g+ R++k+c++rw +yl
   XP_009596112.1 14 RGPWTIDEDHKLLNFILNNGIQCWRMVPKFAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding46.49.1e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       + ++ E+ +++++++ +G++ W++Ia++++ gRt++++k++w++
   XP_009596112.1  68 EPLSEAEENQIIQLHACFGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                      677999***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-20564IPR009057Homeodomain-like
PROSITE profilePS5129413.919961IPR017930Myb domain
SuperFamilySSF466891.61E-2711108IPR009057Homeodomain-like
SMARTSM007174.9E-61363IPR001005SANT/Myb domain
PfamPF002492.1E-101461IPR001005SANT/Myb domain
CDDcd001677.97E-51661No hitNo description
PROSITE profilePS5129424.75962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
SMARTSM007174.6E-1466114IPR001005SANT/Myb domain
PfamPF002492.1E-1368110IPR001005SANT/Myb domain
CDDcd001671.53E-1071110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRQPCCDKV GIKRGPWTID EDHKLLNFIL NNGIQCWRMV PKFAGLLRCG KSCRLRWINY  60
LRPDLKREPL SEAEENQIIQ LHACFGNRWS KIASHFPGRT DNEIKNHWNT RIKKRLKLLG  120
IDPLTHNPIE ALNLENLEQK PDETITQSNM PTHDHETENS STSSDTKKTE TDIKIDDITN  180
DFSIVENDYS NFCGNLDVDL LSNTTKTMSY SLETAESINF SSASTATEYS SSVVPAEGQH  240
SIQQWFYSVD SLFSWDNNVN QLGVGEDFIF WRNYNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009596112.10.0PREDICTED: myb-related protein 315-like
TrEMBLA0A067LG988e-96A0A067LG98_JATCU; MYB family protein
STRINGPGSC0003DMT4000329303e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-76myb domain protein 40